A potential wound-healing-promoting peptide from salamander skin.

نویسندگان

  • Lixian Mu
  • Jing Tang
  • Han Liu
  • Chuanbin Shen
  • Mingqiang Rong
  • Zhiye Zhang
  • Ren Lai
چکیده

Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.

برای دانلود رایگان متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید

ثبت نام

اگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید

منابع مشابه

A Small Peptide with Potential Ability to Promote Wound Healing

Wound-healing represents a major health burden, such as diabetes-induced skin ulcers and burning. Many works are being tried to find ideal clinical wound-healing biomaterials. Especially, small molecules with low cost and function to promote production of endogenous wound healing agents (i.e. transforming growth factor beta, TGF-β) are excellent candidates. In this study, a small peptide (tiger...

متن کامل

Data from proteomic analysis of the skin of Chinese giant salamander (Andrias davidianus)

UNLABELLED The Chinese giant salamander (Andrias davidianus), renowned as a living fossil, is the largest and longest-lived amphibian species in the world. Its skin has developed mucous gland which could secrete a large amount of mucus under the scraping and electric stimulation, and the molting is the degraded skin stratum corneum. Although several proteomic studies have focused on functional ...

متن کامل

Effect of Anodal and Cathodal Microamperage Electrical Stimulation on Injury Potential and Size of Acute Wound in Guinea Pig

Introduction: It is believed that injury potential has a regulatory role in wound healing process and the application of exogenous electrical stimulation may serve to mimic the natural endogenous bioelectric current so that can improve the wound healing. Up to now, this hypothesis has not been researched in surgically acute wounds. Materials and Methods: Thirty nine male guinea pigs were random...

متن کامل

The Healing Potential of Oleaster Leave Water Soluble Extract on Experimental Skin Wounds in the Rat

Objective- To evaluate the healing potential of oleaster leave water soluble extract on skin wounds. Design- Experimental study. Animals- 30 male Spragne-Dawly rats, randomly assigned in two equal groups. Procedures- Under general anesthesia, and following surgical preparation, two uniform skin defects were made by 7mm skin punch. The water soluble extract was then applied on half of the wo...

متن کامل

Healing Potential of Mesenchymal Stem Cells Cultured on a Collagen-Based Scaffold for Skin Regeneration

Background: Wound healing of burned skin remains a major goal in public health. Previous reports showed that the bone marrow stem cells were potent in keratinization and vascularization of full thickness skin wounds. Methods: In this study, mesenchymal stem cells were derived from rat adipose tissues and characterized by flowcytometry. Staining methods were used to evaluate their differentiatio...

متن کامل

ذخیره در منابع من


  با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید

عنوان ژورنال:
  • FASEB journal : official publication of the Federation of American Societies for Experimental Biology

دوره 28 9  شماره 

صفحات  -

تاریخ انتشار 2014